SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000339550|e2vbiG1|2003.1.4.8|G:185-353 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000339550|e2vbiG1|2003.1.4.8|G:185-353
Domain Number 1 Region: 10-160
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 8.41e-32
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000339550|e2vbiG1|2003.1.4.8|G:185-353
Sequence length 169
Sequence
LSEPEIDHTSLKAAVDATVALLEKSASPVMLLGSKLRAANALAATETLADKLQCAVTIMA
AAKGFFPEDHAGFRGLYWGEVSNPGVQELVETSDALLCIAPVFNDYSTVGWSAWPKGPNV
ILAEPDRVTVDGRAYDGFTLRAFLQALAEKAPARPASAQKSSVPTCSLT
Download sequence
Identical sequences 000167612|e2vbiA1|2003.1.4.8|A:185-353 000339535|e2vbiB1|2003.1.4.8|B:185-353 000339538|e2vbiC1|2003.1.4.8|C:185-353 000339541|e2vbiD1|2003.1.4.8|D:185-353 000339544|e2vbiE1|2003.1.4.8|E:185-353 000339547|e2vbiF1|2003.1.4.8|F:185-353 000339550|e2vbiG1|2003.1.4.8|G:185-353 000339553|e2vbiH1|2003.1.4.8|H:185-353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]