SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000407445|e3pd7B1|2111.68.1.1|B:14-107 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000407445|e3pd7B1|2111.68.1.1|B:14-107
Domain Number 1 Region: 5-91
Classification Level Classification E-value
Superfamily BRCT domain 8.24e-21
Family DNA topoisomerase II binding protein 1, TopBP1 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000407445|e3pd7B1|2111.68.1.1|B:14-107
Sequence length 94
Sequence
KPLHKVVVCVSKKLSKKQSELNGIAASLGADYRRSFDETVTHFIYQGRPNDTNREYKSVK
ERGVHIVSEHWLLDCAQECKHLPESLYPHTYNGS
Download sequence
Identical sequences 000407444|e3pd7A1|2111.68.1.1|A:14-107 000407445|e3pd7B1|2111.68.1.1|B:14-107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]