SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000411744|e3p87B1|227.1.1.12|B:1-124 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000411744|e3p87B1|227.1.1.12|B:1-124
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily DNA clamp 9.71e-43
Family DNA polymerase processivity factor 0.000000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000411744|e3p87B1|227.1.1.12|B:1-124
Sequence length 124
Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVE
Download sequence
Identical sequences 000357492|e2zvkC1|227.1.1.12|C:1-124 000357494|e2zvlA1|227.1.1.12|A:1-124 000357496|e2zvlB1|227.1.1.12|B:1-124 000357498|e2zvlC1|227.1.1.12|C:1-124 000357500|e2zvlD1|227.1.1.12|D:1-124 000357508|e2zvmB1|227.1.1.12|B:1-124 000411744|e3p87B1|227.1.1.12|B:1-124 000411746|e3p87C1|227.1.1.12|C:1-124 000411748|e3p87D1|227.1.1.12|D:1-124 000411750|e3p87E1|227.1.1.12|E:1-124 000411752|e3p87F1|227.1.1.12|F:1-124 001144290|e3wgwB1|227.1.1.12|B:1-124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]