SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000421998|e3pc8C1|2111.68.1.5|C:12-88 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000421998|e3pc8C1|2111.68.1.5|C:12-88
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily BRCT domain 1e-16
Family DNA ligase 0.0000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000421998|e3pc8C1|2111.68.1.5|C:12-88
Sequence length 77
Sequence
vlldiftgvrlylppstpdfsrlrryfvafdgdlvqefdmtsathvlgsrdknpaaqqvs
pewiwacirkrrlvaps
Download sequence
Identical sequences 000421995|e3pc7B1|2111.68.1.5|B:12-88 000421998|e3pc8C1|2111.68.1.5|C:12-88 000422163|e3qvgC1|2111.68.1.5|C:13-89 d3pc7b_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]