SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000427452|e3p16B3|227.1.1.4|B:268-406 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000427452|e3p16B3|227.1.1.4|B:268-406
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily DNA clamp 3.35e-27
Family DNA polymerase III, beta subunit 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000427452|e3p16B3|227.1.1.4|B:268-406
Sequence length 139
Sequence
RQLLPTEHTAVATMDVAELIEAIKLVALVADRGAQVRMEFADGSVRLSAGADDVGRAEED
LVVDYAGEPLTIAFNPTYLTDGLSSLRSERVSFGFTTAGKPALLRPVSGDDRPVAGLNGN
GPFPAVSTDYVYLLMPVRL
Download sequence
Identical sequences 000144384|e3p16A3|227.1.1.4|A:268-406 000427452|e3p16B3|227.1.1.4|B:268-406 000427455|e3p16C3|227.1.1.4|C:268-406 000427458|e3p16D3|227.1.1.4|D:268-406 000427461|e3p16E3|227.1.1.4|E:268-406 000427464|e3p16F3|227.1.1.4|F:268-406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]