SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000432135|e3ohvC1|226.1.1.1|C:7-125 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000432135|e3ohvC1|226.1.1.1|C:7-125
Domain Number 1 Region: 3-119
Classification Level Classification E-value
Superfamily POZ domain 3.53e-30
Family BTB/POZ domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000432135|e3ohvC1|226.1.1.1|C:7-125
Sequence length 119
Sequence
myvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwqalvgqt
kndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnledscfsfl
Download sequence
Identical sequences 000432135|e3ohvC1|226.1.1.1|C:7-125 000432137|e3ohvE1|226.1.1.1|E:7-125 d3ohvc_ d3ohve_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]