SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001015612|e4i5lB3|108.1.1.16|B:181-265 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001015612|e4i5lB3|108.1.1.16|B:181-265
Domain Number 1 Region: 4-83
Classification Level Classification E-value
Superfamily EF-hand 0.000000000317
Family Calmodulin-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001015612|e4i5lB3|108.1.1.16|B:181-265
Sequence length 85
Sequence
EEADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHALSTKMIDRIFSGA
VTRGRKVQKEGKISYADFVWFLISE
Download sequence
Identical sequences 001015612|e4i5lB3|108.1.1.16|B:181-265 001015617|e4i5nB3|108.1.1.16|B:181-265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]