SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001030720|e4jtdH2|226.1.1.2|H:51-164 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001030720|e4jtdH2|226.1.1.2|H:51-164
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily POZ domain 9.68e-29
Family Tetramerization domain of potassium channels 0.00000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001030720|e4jtdH2|226.1.1.2|H:51-164
Sequence length 114
Sequence
SERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYY
YQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEF
Download sequence
Identical sequences 000331773|e2r9rH2|226.1.1.2|H:51-164 001030711|e4jtcH2|226.1.1.2|H:51-164 001030720|e4jtdH2|226.1.1.2|H:51-164 001387008|e4jtaQ1|226.1.1.2|Q:51-164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]