SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001095843|e3vwuC1|2485.1.1.1|C:60-236 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001095843|e3vwuC1|2485.1.1.1|C:60-236
Domain Number 1 Region: 5-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.29e-63
Family Glutathione peroxidase-like 0.000000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001095843|e3vwuC1|2485.1.1.1|C:60-236
Sequence length 177
Sequence
LSKAKISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRI
EEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDS
GHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPG
Download sequence
Identical sequences 001095843|e3vwuC1|2485.1.1.1|C:60-236 cath|current|3vwuA00/79-255 cath|current|3vwuC00/79-255 cath|current|3vwuH00/79-255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]