SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001107262|e4llrG1|2485.1.1.1|G:4-197 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001107262|e4llrG1|2485.1.1.1|G:4-197
Domain Number 1 Region: 4-192
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.11e-68
Family Glutathione peroxidase-like 0.00000000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001107262|e4llrG1|2485.1.1.1|G:4-197
Sequence length 194
Sequence
gdaklnhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
mkpdpekskeyfga
Download sequence
Identical sequences 001107256|e4llrA1|2485.1.1.1|A:4-197 001107257|e4llrB1|2485.1.1.1|B:4-197 001107258|e4llrC1|2485.1.1.1|C:4-197 001107259|e4llrD1|2485.1.1.1|D:4-197 001107260|e4llrE1|2485.1.1.1|E:4-197 001107261|e4llrF1|2485.1.1.1|F:4-197 001107262|e4llrG1|2485.1.1.1|G:4-197 001107263|e4llrH1|2485.1.1.1|H:4-197 001107264|e4llrI1|2485.1.1.1|I:4-197 001107265|e4llrJ1|2485.1.1.1|J:4-197 d4llra_ d4llrb_ d4llrc_ d4llrd_ d4llre_ d4llrf_ d4llrg_ d4llrh_ d4llri_ d4llrj_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]