SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001107941|e1bw0A3|3016.1.1.19|A:310-415 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001107941|e1bw0A3|3016.1.1.19|A:310-415
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.84e-17
Family AAT-like 0.00000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001107941|e1bw0A3|3016.1.1.19|A:310-415
Sequence length 106
Sequence
HLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKYRDIKTDVEFFEKLL
EEENVQVLPGTIFHAPGFTRLTTTRPVEVYREAVERIKAFCQRHAA
Download sequence
Identical sequences 001107941|e1bw0A3|3016.1.1.19|A:310-415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]