SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001111859|e4lnjA2|3016.1.1.31|A:245-332 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001111859|e4lnjA2|3016.1.1.31|A:245-332
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000000000117
Family AAT-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001111859|e4lnjA2|3016.1.1.31|A:245-332
Sequence length 88
Sequence
NVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVLINAS
PIVRLVTHLDVSRAQLAEVAAHWRAFLA
Download sequence
Identical sequences 001111859|e4lnjA2|3016.1.1.31|A:245-332 001111875|e4lnlA2|3016.1.1.31|A:245-332 001111877|e4lnlB2|3016.1.1.31|B:245-332 001405623|e4rjyA2|3016.1.1.31|A:245-332 001405625|e4rjyB2|3016.1.1.31|B:245-332 001405627|e4rjyC2|3016.1.1.31|C:245-332 001405629|e4rjyD2|3016.1.1.31|D:245-332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]