SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001111881|e4lnmB2|3016.1.1.31|B:244-331 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001111881|e4lnmB2|3016.1.1.31|B:244-331
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000000000188
Family AAT-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001111881|e4lnmB2|3016.1.1.31|B:244-331
Sequence length 88
Sequence
NNVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVLINA
SPIVRLVTHLDVSRAQLAEVAAHWRAFL
Download sequence
Identical sequences 001111879|e4lnmA2|3016.1.1.31|A:244-331 001111881|e4lnmB2|3016.1.1.31|B:244-331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]