SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001117312|e1y5lB2|205.1.1.9|B:184-243 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001117312|e1y5lB2|205.1.1.9|B:184-243
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1e-29
Family Ferredoxin domains from multidomain proteins 0.0000858
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001117312|e1y5lB2|205.1.1.9|B:184-243
Sequence length 60
Sequence
CEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEK
Download sequence
Identical sequences 001107989|e1y5iB3|205.1.1.9|B:184-243 001114392|e3egwB2|205.1.1.9|B:184-243 001115400|e3ir5B2|205.1.1.9|B:184-243 001115402|e3ir6B2|205.1.1.9|B:184-243 001115404|e3ir7B2|205.1.1.9|B:184-243 001116303|e1q16B2|205.1.1.9|B:184-243 001116642|e1siwB2|205.1.1.9|B:184-243 001117308|e1y4zB2|205.1.1.9|B:184-243 001117312|e1y5lB2|205.1.1.9|B:184-243 001117314|e1y5nB2|205.1.1.9|B:184-243 001395051|e1r27D1|205.1.1.9|D:184-243 001626361|e1r27B1|205.1.1.9|B:184-243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]