SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001126158|e4ml6D1|2485.1.1.220|D:65-215 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001126158|e4ml6D1|2485.1.1.220|D:65-215
Domain Number 1 Region: 17-150
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.33e-16
Family DsbC/DsbG C-terminal domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001126158|e4ml6D1|2485.1.1.220|D:65-215
Sequence length 151
Sequence
SQMRDVAERIHFKSMGMDVDTLNTVSMGRGDKEVVVFVDPRCAVCHQLMGDAKSLVDDYT
FKFIVIPALGAESNRLAKNLYCAKDKTHALDALMNNTLGSLPSKETCDPGQYDQTLLTAH
FIGIEGVPFVVAPDGRVSKGRPKNLKSWLES
Download sequence
Identical sequences 001126148|e4ml1A1|2485.1.1.220|A:65-215 001126154|e4ml6B1|2485.1.1.220|B:65-215 001126158|e4ml6D1|2485.1.1.220|D:65-215 001126166|e4mlyD1|2485.1.1.220|D:65-215 001137396|e4mlyB1|2485.1.1.220|B:65-215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]