SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001144937|e4nscC2|108.1.1.178|C:230-389 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001144937|e4nscC2|108.1.1.178|C:230-389
Domain Number 1 Region: 15-136
Classification Level Classification E-value
Superfamily EF-hand 0.000000000194
Family Calmodulin-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001144937|e4nscC2|108.1.1.178|C:230-389
Sequence length 160
Sequence
HDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGKGLTFQEV
ENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDG
NGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCA
Download sequence
Identical sequences 001144937|e4nscC2|108.1.1.178|C:230-389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]