SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001152573|e1mlzB3|3016.1.1.17|B:330-428 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001152573|e1mlzB3|3016.1.1.17|B:330-428
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000000325
Family GABA-aminotransferase-like 0.00000482
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001152573|e1mlzB3|3016.1.1.17|B:330-428
Sequence length 99
Sequence
GDWQQQVADIEVQLREQLAPARDAEMVADVRVLGAIGVVETTHPVNMAALQKFFVEQGVW
IRPFGKLIYLMPPYIILPQQLQRLTAAVNRAVQDETFFC
Download sequence
Identical sequences 000263564|e1s0aB2|3016.1.1.17|B:330-428 001152551|e1s09A3|3016.1.1.17|A:330-428 001152553|e1s09B3|3016.1.1.17|B:330-428 001152557|e1s07B3|3016.1.1.17|B:330-428 001152559|e1qj3A3|3016.1.1.17|A:330-428 001152561|e1s06B3|3016.1.1.17|B:330-428 001152569|e1qj3B3|3016.1.1.17|B:330-428 001152571|e1mlyA3|3016.1.1.17|A:330-428 001152573|e1mlzB3|3016.1.1.17|B:330-428 001152577|e1s08B3|3016.1.1.17|B:330-428 001152581|e1mlyB3|3016.1.1.17|B:330-428 001152583|e1mlzA3|3016.1.1.17|A:330-428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]