SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001153673|e4el1B19|2485.1.1.40|B:358-481 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001153673|e4el1B19|2485.1.1.40|B:358-481
Domain Number 1 Region: 13-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.43e-33
Family PDI-like 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001153673|e4el1B19|2485.1.1.40|B:358-481
Sequence length 124
Sequence
LMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETY
KDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGG
QDGA
Download sequence
Identical sequences 000145404|e3uemA2|2485.1.1.40|A:237-360 001153673|e4el1B19|2485.1.1.40|B:358-481 001196644|e4el1A31|2485.1.1.40|A:358-481 001197244|e4ekzA6|2485.1.1.40|A:358-481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]