SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001154430|e3kheB5|108.1.1.109|B:120-191 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001154430|e3kheB5|108.1.1.109|B:120-191
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily EF-hand 6.08e-20
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001154430|e3kheB5|108.1.1.109|B:120-191
Sequence length 72
Sequence
LSRERLLAAFQQFDSDGSGKITNEELGRLFGVTEVDDETWHQVLQECDKNNDGEVDFEEF
VEMMQKICDVKV
Download sequence
Identical sequences 001154430|e3kheB5|108.1.1.109|B:120-191 001154769|e3kheA2|108.1.1.109|A:120-191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]