SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001154476|e2dfsD3|108.1.1.109|D:80-148 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001154476|e2dfsD3|108.1.1.109|D:80-148
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily EF-hand 2.65e-29
Family Calmodulin-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001154476|e2dfsD3|108.1.1.109|D:80-148
Sequence length 69
Sequence
DSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE
EFVQMMTAK
Download sequence
Identical sequences 000149921|e2ll6A2|108.1.1.109|A:80-148 000150584|e2lgfA2|108.1.1.109|A:78-146 000150958|e4dckB2|108.1.1.109|B:81-149 000280320|e1up5A2|108.1.1.109|A:80-148 000358602|e3g43D2|108.1.1.109|D:80-148 000359126|e2k0jA2|108.1.1.109|A:80-148 000374916|e3ewvA2|108.1.1.109|A:86-154 000437297|e2y4vA2|108.1.1.109|A:81-149 000864324|e3u0kA3|108.1.1.109|A:372-440 001154476|e2dfsD3|108.1.1.109|D:80-148 001154478|e1cfdA4|108.1.1.109|A:80-148 001154480|e1cfcA4|108.1.1.109|A:80-148 001154482|e2dfsN3|108.1.1.109|N:80-148 001154484|e2dfsB3|108.1.1.109|B:80-148 001154486|e2dfsR3|108.1.1.109|R:80-148 001154488|e2dfsP3|108.1.1.109|P:80-148 001154490|e2dfsF3|108.1.1.109|F:80-148 001198882|e2dfsE3|108.1.1.109|E:80-148 001198884|e2dfsQ3|108.1.1.109|Q:80-148 001283849|e4byfD2|108.1.1.109|D:81-149 001285571|e4jpzC2|108.1.1.109|C:81-149 001285573|e4jpzI2|108.1.1.109|I:81-149 001289163|e4lzxA2|108.1.1.109|A:80-148 001854699|e2n27A2|108.1.1.109|A:80-148 001870780|e5dowA1|108.1.1.109|A:80-148 001890055|e2n8jA2|108.1.1.109|A:80-148 002028544|e5t0xA1|108.1.1.109|A:80-148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]