SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001193165|e3aenD2|3016.1.1.83|D:256-388 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001193165|e3aenD2|3016.1.1.83|D:256-388
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.12e-40
Family Cystathionine synthase-like 0.0000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001193165|e3aenD2|3016.1.1.83|D:256-388
Sequence length 133
Sequence
PIRMQIHMENGLKVAKFLEQHEKIVKVNHPGLESFPGHDIAKKQMTGYGSTFLFEMKSFE
AAKKLMEHLKVCTLAVSLGCVDTLIEHPASMTHAAVPENIMRKQGITPELVRISVGIENV
DDIIADLKQALEL
Download sequence
Identical sequences 001193105|e3aejD2|3016.1.1.83|D:256-388 001193119|e3aejB2|3016.1.1.83|B:256-388 001193121|e3aelB2|3016.1.1.83|B:256-388 001193123|e3aemB2|3016.1.1.83|B:256-388 001193129|e3aenB2|3016.1.1.83|B:256-388 001193131|e3aepB2|3016.1.1.83|B:256-388 001193133|e3aepD2|3016.1.1.83|D:256-388 001193141|e3aeoB2|3016.1.1.83|B:256-388 001193153|e3aczD2|3016.1.1.83|D:256-388 001193155|e3aczB2|3016.1.1.83|B:256-388 001193157|e3aelD2|3016.1.1.83|D:256-388 001193159|e3aeoD2|3016.1.1.83|D:256-388 001193165|e3aenD2|3016.1.1.83|D:256-388 001193169|e3aemD2|3016.1.1.83|D:256-388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]