SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001193893|e2zyjB3|3016.1.1.264|B:286-397 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001193893|e2zyjB3|3016.1.1.264|B:286-397
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.97e-26
Family AAT-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001193893|e2zyjB3|3016.1.1.264|B:286-397
Sequence length 112
Sequence
FSERLERVRRVYREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRAL
EENVAFVPGGPFFANGGGENTLRLSYATLDREGIAEGVRRLGRALKGLLALV
Download sequence
Identical sequences 001193650|e2z1yA3|3016.1.1.264|A:286-397 001193652|e2z1yB3|3016.1.1.264|B:286-397 001193816|e2zyjA3|3016.1.1.264|A:286-397 001193882|e2egyC3|3016.1.1.264|C:286-397 001193893|e2zyjB3|3016.1.1.264|B:286-397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]