SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001194086|e1rv4A2|3016.1.1.91|A:321-483 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001194086|e1rv4A2|3016.1.1.91|A:321-483
Domain Number 1 Region: 1-159
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.34e-48
Family GABA-aminotransferase-like 0.0000000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001194086|e1rv4A2|3016.1.1.91|A:321-483
Sequence length 163
Sequence
PEFKEYQRQVVANCRALSAALVELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACS
IACNKNTCPGDKSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTVQIQDDTGP
RATLKEFKEKLAGDEKHQRAVRALRQEVESFAALFPLPGLPGF
Download sequence
Identical sequences 001152716|e1ls3A2|3016.1.1.91|A:321-483 001194062|e1rvuA2|3016.1.1.91|A:321-483 001194068|e1rv3B2|3016.1.1.91|B:321-483 001194070|e1rv3A2|3016.1.1.91|A:321-483 001194072|e1rvuB2|3016.1.1.91|B:321-483 001194076|e1rv4B2|3016.1.1.91|B:321-483 001194078|e1ls3D2|3016.1.1.91|D:321-483 001194080|e1rvyB2|3016.1.1.91|B:321-483 001194082|e1rvyA2|3016.1.1.91|A:321-483 001194086|e1rv4A2|3016.1.1.91|A:321-483 001194088|e1cj0A2|3016.1.1.91|A:308-470 001194090|e1ls3C2|3016.1.1.91|C:321-483 001194094|e1cj0B2|3016.1.1.91|B:308-470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]