SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001196160|e3iasU9|5100.1.1.1|U:96-161 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001196160|e3iasU9|5100.1.1.1|U:96-161
Domain Number 1 Region: 2-51
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000163
Family Ferredoxin domains from multidomain proteins 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001196160|e3iasU9|5100.1.1.1|U:96-161
Sequence length 66
Sequence
LSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYT
RFEFTR
Download sequence
Identical sequences 001153508|e4heaD14|5100.1.1.1|D:96-161 001196110|e2ybb39|5100.1.1.1|3:96-161 001196115|e3m9s39|5100.1.1.1|3:96-161 001196120|e3i9vC9|5100.1.1.1|C:96-161 001196125|e3iam39|5100.1.1.1|3:96-161 001196130|e3iamC9|5100.1.1.1|C:96-161 001196135|e3m9sC9|5100.1.1.1|C:96-161 001196140|e4hea39|5100.1.1.1|3:96-161 001196145|e3ias39|5100.1.1.1|3:96-161 001196150|e3iasC9|5100.1.1.1|C:96-161 001196155|e3iasL9|5100.1.1.1|L:96-161 001196160|e3iasU9|5100.1.1.1|U:96-161 001705726|e3i9v34|5100.1.1.1|3:96-161 001765162|e2fugC6|5100.1.1.1|C:96-161 001772472|e2fugL5|5100.1.1.1|L:96-161 001772482|e2fugU9|5100.1.1.1|U:96-161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]