SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001196970|e4mcuF3|2485.1.1.53|F:5-67,F:130-190 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001196970|e4mcuF3|2485.1.1.53|F:5-67,F:130-190
Domain Number 1 Region: 2-122
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.17e-28
Family DsbA-like 0.00000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001196970|e4mcuF3|2485.1.1.53|F:5-67,F:130-190
Sequence length 124
Sequence
ITDGKQYITLDKPIAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTKYHVE
FLGFVVKSLVAQQEKAAADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADTVKQL
VEKK
Download sequence
Identical sequences 001196970|e4mcuF3|2485.1.1.53|F:5-67,F:130-190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]