SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001196974|e4mcuB3|2485.1.1.53|B:1-67,B:130-189 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001196974|e4mcuB3|2485.1.1.53|B:1-67,B:130-189
Domain Number 1 Region: 4-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.74e-29
Family DsbA-like 0.00000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001196974|e4mcuB3|2485.1.1.53|B:1-67,B:130-189
Sequence length 127
Sequence
SNAQITDGKQYITLDKPIAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTK
YHVEFLGFVVKSLVAQQEKAAADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADT
VKQLVEK
Download sequence
Identical sequences 001196974|e4mcuB3|2485.1.1.53|B:1-67,B:130-189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]