SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001197007|e3e9jB3|2485.1.1.53|B:1-65,B:129-188 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001197007|e3e9jB3|2485.1.1.53|B:1-65,B:129-188
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.83e-26
Family DsbA-like 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001197007|e3e9jB3|2485.1.1.53|B:1-65,B:129-188
Sequence length 125
Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYH
VNFMGFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVK
YLSEK
Download sequence
Identical sequences 001153759|e2hi7A3|2485.1.1.53|A:1-65,A:129-188 001153775|e1u3aE3|2485.1.1.53|E:1-65,E:129-188 001197000|e2zupA3|2485.1.1.53|A:1-65,A:129-188 001197007|e3e9jB3|2485.1.1.53|B:1-65,B:129-188 001197009|e3e9jE3|2485.1.1.53|E:1-65,E:129-188 001197015|e2legA3|2485.1.1.53|A:1-65,A:129-188 001489255|e4tkyA2|2485.1.1.53|A:3-67,A:131-190 001489257|e4tkyB2|2485.1.1.53|B:3-67,B:131-190 001489259|e4tkyC2|2485.1.1.53|C:3-67,C:131-190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]