SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001198108|e2q4uA6|108.1.1.43|A:134-272 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001198108|e2q4uA6|108.1.1.43|A:134-272
Domain Number 1 Region: 12-133
Classification Level Classification E-value
Superfamily EF-hand 6.33e-16
Family Calmodulin-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001198108|e2q4uA6|108.1.1.43|A:134-272
Sequence length 139
Sequence
FLQHKKKIPPNKLDEYTDAMMKIFDKNKDGRLDLNDLARILALQENFLLQFKMDASSQVE
RKRDFEKIFAHYDVSRTGALEGPEVDGFVKDMMELVRPSISGGDLDKFRECLLTHCDMNK
DGKIQKSELALCLGLKHKP
Download sequence
Identical sequences 001198108|e2q4uA6|108.1.1.43|A:134-272 001758987|e2be4A2|108.1.1.43|A:134-272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]