SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001198335|e2os8C3|108.1.1.51|C:2-81 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001198335|e2os8C3|108.1.1.51|C:2-81
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000117
Family Calmodulin-like 0.0000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001198335|e2os8C3|108.1.1.51|C:2-81
Sequence length 80
Sequence
PKLSQDEIDDLKEVFELFDFWDGRDGAVDAFKIGDVCRCLGINPRNEDVFAVGGTHKMGE
KSLPFEEFLPAYEGLMDCEQ
Download sequence
Identical sequences 001198335|e2os8C3|108.1.1.51|C:2-81 001198373|e2otgC3|108.1.1.51|C:2-81

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]