SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001246922|e2q5qB9|2003.1.4.8|B:202-372 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001246922|e2q5qB9|2003.1.4.8|B:202-372
Domain Number 1 Region: 3-155
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.43e-28
Family Pyruvate oxidase and decarboxylase, middle domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001246922|e2q5qB9|2003.1.4.8|B:202-372
Sequence length 171
Sequence
PVDRDALAACADEVLAAMRSATSPVLMVCVEVRRYGLEAKVAELAQRLGVPVVTTFMGRG
LLADAPTPPLGTYIGVAGDAEITRLVEESDGLFLLGAILSDTNFAVSQRKIDLRKTIHAF
DRAVTLGYHTYADIPLAGLVDALLERLPPSDRTTRGKEPHAYPTGLQADGE
Download sequence
Identical sequences 001246916|e2q5qA9|2003.1.4.8|A:202-372 001246922|e2q5qB9|2003.1.4.8|B:202-372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]