SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001281494|e4l6v31|205.1.1.6|3:2-81 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001281494|e4l6v31|205.1.1.6|3:2-81
Domain Number 1 Region: 6-65
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000147
Family 7-Fe ferredoxin 0.0000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001281494|e4l6v31|205.1.1.6|3:2-81
Sequence length 80
Sequence
shsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacptd
flsirvylgaettrsmglay
Download sequence
Identical sequences 5oy0_3 5oy0_C 001144399|e4kt0C1|205.1.1.6|C:2-81 001281492|e4l6vC1|205.1.1.6|C:2-81 001281493|e4l6vc1|205.1.1.6|c:2-81 001281494|e4l6v31|205.1.1.6|3:2-81 d4kt0c_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]