SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001283952|e4cr421|210.1.1.4|2:30-252 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001283952|e4cr421|210.1.1.4|2:30-252
Domain Number 1 Region: 1-219
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.29e-59
Family Proteasome subunits 0.00000000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001283952|e4cr421|210.1.1.4|2:30-252
Sequence length 223
Sequence
TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIG
SNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTD
VGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEI
GKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICDI
Download sequence
Identical sequences 001283895|e4cr221|210.1.1.4|2:30-252 001283927|e4cr321|210.1.1.4|2:30-252 001283952|e4cr421|210.1.1.4|2:30-252 001567991|e5a5b21|210.1.1.4|2:30-252 002047338|e5wvk21|210.1.1.4|2:30-252 002047339|e5wvki1|210.1.1.4|i:30-252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]