SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001290743|e2m9gA1|108.1.1.8|A:1-92 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001290743|e2m9gA1|108.1.1.8|A:1-92
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily EF-hand 7.96e-23
Family S100 proteins 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001290743|e2m9gA1|108.1.1.8|A:1-92
Sequence length 92
Sequence
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQG
LDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Download sequence
Identical sequences P80511
ENSP00000357726 ENSP00000357726 ENSP00000357726 001290743|e2m9gA1|108.1.1.8|A:1-92 001290744|e2m9gB1|108.1.1.8|B:1-92 cath|current|2m9gA00/1-92 cath|current|2m9gB00/1-92 d2m9ga_ d2m9gb_ 9606.ENSP00000357726 2m9g_A 2m9g_B gi|5032059|ref|NP_005612.1| NP_005612.1.87134 NP_005612.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]