SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001324249|e4utnB2|2003.1.4.33|B:10-123,B:185-275 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001324249|e4utnB2|2003.1.4.33|B:10-123,B:185-275
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.63e-68
Family Sir2 family of transcriptional regulators 0.0000000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001324249|e4utnB2|2003.1.4.33|B:10-123,B:185-275
Sequence length 205
Sequence
SSDLTAFREHFAKAKHIAIITGAGVSAESGVPTFRGPGGFWRKWQAQDLATPEAFSRDPS
LVWEFYHYRREVMRSKMPNPAHLAIAECEARLGQQGRSVVIITQNIDELHHRAGCNGLLR
PHVVWFGETLDSDILTAVERELEKCDLCLVVGTSSIVYPAAMFAPQVASRGVPVAEFNME
CTPATQRFKYHFEGPCGSTLPPALE
Download sequence
Identical sequences 001324249|e4utnB2|2003.1.4.33|B:10-123,B:185-275 001324257|e4utvB2|2003.1.4.33|B:10-123,B:185-275 001324261|e4utxB2|2003.1.4.33|B:10-123,B:185-275 001324265|e4utzB2|2003.1.4.33|B:10-123,B:185-275 001324269|e4uu7B2|2003.1.4.33|B:10-123,B:185-275 001324273|e4uu8B2|2003.1.4.33|B:10-123,B:185-275 001324277|e4uuaB2|2003.1.4.33|B:10-123,B:185-275 001324281|e4uubB2|2003.1.4.33|B:10-123,B:185-275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]