SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001406066|e4pe0X1|108.1.1.146|X:1-89 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001406066|e4pe0X1|108.1.1.146|X:1-89
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily EF-hand 3.74e-24
Family S100 proteins 0.0000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001406066|e4pe0X1|108.1.1.146|X:1-89
Sequence length 89
Sequence
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheff
Download sequence
Identical sequences 4fqo_A 000153199|e4fqoA1|108.1.1.146|A:1-89 000382533|e3iqqA1|108.1.1.146|A:1-89 000409023|e3lk0A1|108.1.1.146|A:1-89 000409024|e3lk0B1|108.1.1.146|B:1-89 000409025|e3lk0C1|108.1.1.146|C:1-89 001400640|e4pe1A1|108.1.1.146|A:1-89 001406066|e4pe0X1|108.1.1.146|X:1-89 001726095|e5dkrA1|108.1.1.146|A:1-89 cath|current|4fqoA00/0-88 d3iqqa_ d3lk0a_ d3lk0b_ d3lk0c_ d4fqoa_ d4pe0x_ d4pe1a_ d5dkra_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]