SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001519400|e4yy8B2|226.1.1.14|B:13-108 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001519400|e4yy8B2|226.1.1.14|B:13-108
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily POZ domain 1.06e-24
Family Tetramerization domain of potassium channels 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001519400|e4yy8B2|226.1.1.14|B:13-108
Sequence length 96
Sequence
TMIDINVGGAIFETSRHTLTQQKDSFIEKLLSGRHHVTRDKQGRIFLDRDSELFRIILNF
LRNPLTIPIPKDLSESEALLKEAEFYGIKFLPFPLV
Download sequence
Identical sequences 001519398|e4yy8A2|226.1.1.14|A:13-108 001519400|e4yy8B2|226.1.1.14|B:13-108 001559077|e4zgcA1|226.1.1.14|A:13-108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]