SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001699997|e5a15H1|226.1.1.14|H:10-111 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001699997|e5a15H1|226.1.1.14|H:10-111
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily POZ domain 5.3e-31
Family Tetramerization domain of potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001699997|e5a15H1|226.1.1.14|H:10-111
Sequence length 102
Sequence
FPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSPKRDTANDLAKDSKGRFFIDRDGFLF
RYILDYLRDRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLTP
Download sequence
Identical sequences 001699990|e5a15A1|226.1.1.14|A:10-111 001699991|e5a15B1|226.1.1.14|B:10-111 001699992|e5a15C1|226.1.1.14|C:10-111 001699993|e5a15D1|226.1.1.14|D:10-111 001699994|e5a15E1|226.1.1.14|E:10-111 001699995|e5a15F1|226.1.1.14|F:10-111 001699996|e5a15G1|226.1.1.14|G:10-111 001699997|e5a15H1|226.1.1.14|H:10-111 001699998|e5a15I1|226.1.1.14|I:10-111 001699999|e5a15J1|226.1.1.14|J:10-111 001700000|e5a15K1|226.1.1.14|K:10-111 001700001|e5a15L1|226.1.1.14|L:10-111 001700002|e5a15M1|226.1.1.14|M:10-111 001700003|e5a15N1|226.1.1.14|N:10-111 001700004|e5a15O1|226.1.1.14|O:10-111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]