SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001765176|e2fugU6|205.1.1.6|U:162-246 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001765176|e2fugU6|205.1.1.6|U:162-246
Domain Number 1 Region: 4-83
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.54e-20
Family Ferredoxin domains from multidomain proteins 0.00000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001765176|e2fugU6|205.1.1.6|U:162-246
Sequence length 85
Sequence
RHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSG
FSGNITDICPVGALLDLTARFRARN
Download sequence
Identical sequences 000005488|e2fug33|205.1.1.6|3:162-246 001153506|e4heaD12|205.1.1.6|D:162-246 001196108|e2ybb37|205.1.1.6|3:162-246 001196113|e3m9s37|205.1.1.6|3:162-246 001196118|e3i9vC7|205.1.1.6|C:162-246 001196123|e3iam37|205.1.1.6|3:162-246 001196128|e3iamC7|205.1.1.6|C:162-246 001196133|e3m9sC7|205.1.1.6|C:162-246 001196138|e4hea37|205.1.1.6|3:162-246 001196143|e3ias37|205.1.1.6|3:162-246 001196148|e3iasC7|205.1.1.6|C:162-246 001196153|e3iasL7|205.1.1.6|L:162-246 001196158|e3iasU7|205.1.1.6|U:162-246 001705725|e3i9v33|205.1.1.6|3:162-246 001765163|e2fugC7|205.1.1.6|C:162-246 001765165|e2fugL2|205.1.1.6|L:162-246 001765176|e2fugU6|205.1.1.6|U:162-246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]