SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001810662|e4ygbB1|108.1.1.16|B:27-101 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001810662|e4ygbB1|108.1.1.16|B:27-101
Domain Number 1 Region: 6-74
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000228
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001810662|e4ygbB1|108.1.1.16|B:27-101
Sequence length 75
Sequence
PQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDD
DKNNDGYIDYAEFAK
Download sequence
Identical sequences 001810662|e4ygbB1|108.1.1.16|B:27-101 001810663|e4ygbD1|108.1.1.16|D:27-101 001810677|e4ygdD1|108.1.1.16|D:27-101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]