SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001871331|e2ncpA1|108.1.1.42|A:1-102 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001871331|e2ncpA1|108.1.1.42|A:1-102
Domain Number 1 Region: 14-86
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000596
Family Calbindin D9K 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001871331|e2ncpA1|108.1.1.42|A:1-102
Sequence length 102
Sequence
SSKPKYNPEVEAKLDVARRLFKRYDKDGSGQLQDDEIAGLLKDTYAEMGMSNFTPTKEDV
KIWLQMADTNSDGSVSLEEYEDLIIKSLQKAGIRVEKQSLVF
Download sequence
Identical sequences 001871330|e2ncoA1|108.1.1.42|A:1-102 001871331|e2ncpA1|108.1.1.42|A:1-102 2nco_A 2ncp_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]