SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001871492|e5frqA1|227.1.1.4|A:248-375 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001871492|e5frqA1|227.1.1.4|A:248-375
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily DNA clamp 0.0000000000000334
Family DNA polymerase III, beta subunit 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001871492|e5frqA1|227.1.1.4|A:248-375
Sequence length 128
Sequence
QKILPKEYISSFTLGKEEFKESIKLCSSLSSTIKLTLEKNNALFESLDSEHSETAKTSVE
IEKGLDIEKAFHLGVNAKFFLEALNALGTTQFVLRCNEPSSPFLIQESLDEKQSHLNAKI
STLMMPIT
Download sequence
Identical sequences 001871492|e5frqA1|227.1.1.4|A:248-375 001871499|e5frqC2|227.1.1.4|C:248-375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]