SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001871495|e5frqB1|227.1.1.3|B:124-247 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001871495|e5frqB1|227.1.1.3|B:124-247
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily DNA clamp 6.8e-17
Family DNA polymerase III, beta subunit 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001871495|e5frqB1|227.1.1.3|B:124-247
Sequence length 124
Sequence
DPKVSIEVNAPFLVDAFKKIAPVIEQTSHKRELAGILMQFDQKHQTLSVVGTDTKRLSYT
QLEKISIHSTEEDISCILPKRALLEILKLFYENFSFKSDGMLAVIENEMHTFFTKLIDGN
YPDY
Download sequence
Identical sequences 001723301|e4rkiA3|227.1.1.3|A:122-245 001734377|e4s3iA2|227.1.1.3|A:124-247 001734380|e4s3iB2|227.1.1.3|B:124-247 001871493|e5frqA2|227.1.1.3|A:124-247 001871495|e5frqB1|227.1.1.3|B:124-247 001871500|e5frqC3|227.1.1.3|C:124-247 001871503|e5frqD3|227.1.1.3|D:124-247 002031855|e5fveA1|227.1.1.3|A:122-245 002086885|e5g48A1|227.1.1.3|A:122-245 002086889|e5g48B2|227.1.1.3|B:122-245 002086892|e5g4qA2|227.1.1.3|A:122-245 002086894|e5g4qB1|227.1.1.3|B:122-245 002100918|e5fxtA2|227.1.1.3|A:122-245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]