SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001884624|e5d43B2|108.1.1.51|B:101-174 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001884624|e5d43B2|108.1.1.51|B:101-174
Domain Number 1 Region: 2-69
Classification Level Classification E-value
Superfamily EF-hand 6.15e-22
Family Calmodulin-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001884624|e5d43B2|108.1.1.51|B:101-174
Sequence length 74
Sequence
DTKEEILKAFRLFDDDETGKISFKNLKRVANELGESLTDEELQEMIDEADRDGDGEVNEE
EFLKIMKKTNLYHH
Download sequence
Identical sequences 001884624|e5d43B2|108.1.1.51|B:101-174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]