SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001889997|e5d08A2|205.1.1.20|A:215-291 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001889997|e5d08A2|205.1.1.20|A:215-291
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000385
Family 7-Fe ferredoxin 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001889997|e5d08A2|205.1.1.20|A:215-291
Sequence length 77
Sequence
MCGSCTKCLDACPTGALVNPGQLNAQRCISFLTQTKGFLPDEFRTKIGNRLYGCDTCQTV
CPLNKGKDFHLHPEMEP
Download sequence
Identical sequences 001889997|e5d08A2|205.1.1.20|A:215-291 001906313|e5d0aB3|205.1.1.20|B:215-291 001906314|e5d0aC1|205.1.1.20|C:215-291 001906318|e5d0bA2|205.1.1.20|A:215-291 001906557|e5t8yA2|205.1.1.20|A:215-291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]