SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001948885|e5k35B1|226.1.1.5|B:2-160 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001948885|e5k35B1|226.1.1.5|B:2-160
Domain Number 1 Region: 84-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.96e-32
Family Skp1 dimerisation domain-like 0.00000653
Further Details:      
 
Domain Number 2 Region: 2-69
Classification Level Classification E-value
Superfamily POZ domain 1.23e-25
Family BTB/POZ domain 0.0000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001948885|e5k35B1|226.1.1.5|B:2-160
Sequence length 159
Sequence
PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQW
CTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCK
TVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWC
Download sequence
Identical sequences 001948885|e5k35B1|226.1.1.5|B:2-160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]