SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 002097704|e5mavD1|227.1.1.12|D:6-127 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  002097704|e5mavD1|227.1.1.12|D:6-127
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily DNA clamp 7.14e-41
Family DNA polymerase processivity factor 0.000000753
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 002097704|e5mavD1|227.1.1.12|D:6-127
Sequence length 122
Sequence
EARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRC
DRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLD
VE
Download sequence
Identical sequences 002097704|e5mavD1|227.1.1.12|D:6-127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]