SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1b8hC00/1-228 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1b8hC00/1-228
Domain Number 1 Region: 111-228
Classification Level Classification E-value
Superfamily DNA clamp 4.39e-44
Family DNA polymerase processivity factor 0.000000442
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily DNA clamp 5.05e-42
Family DNA polymerase processivity factor 0.000000807
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|1b8hC00/1-228
Sequence length 228
Sequence
MKLSKDTIAILKNFASINSGILLSQGKFIMTRAVNGTTYAEANISDEIDFDVALYDLNSF
LSILSLVSDDAEISMHTDGNIKIADTRSTVYWPAADKSTIVFPNKPIQFPVASVITEIKA
EDLQQLLRVSRGLQIDTIAITNKDGKIVINGYNKVEDSGLTRPKYSLTLTDYDGSNNFNF
VINMANMKIQPGNYKVMLWGAGDKVAAKFESSQVSYVIAMEADSTHDF
Download sequence
Identical sequences A0A060BMP5 A0A067ZJS1 A0A088FVC1 A0A0F6R6N6 A0A0F6R913 A0A0F6TIA9 A0A0U2DEC6 A0A0U4KK64 A0A1W6JUI8 A0A218M9Q7 O80164
1b77A cath|current|1b77A00/1-228 cath|current|1b77B00/1-228 cath|current|1b77C00/1-228 cath|current|1b8hA00/1-228 cath|current|1b8hB00/1-228 cath|current|1b8hC00/1-228 1b77_A 1b77_B 1b77_C 1b8h_A 1b8h_B 1b8h_C NP_861750.1.41520 WP_015971447.1.39350 YP_009037449.1.86679 YP_009056644.1.94783 YP_009100599.1.11273 YP_009225206.1.40377 DPA5_BPR69 gi|32453544|ref|NP_861750.1| gi|642905919|ref|YP_009037449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]