SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1dsxG00/33-119 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1dsxG00/33-119
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily POZ domain 1.93e-37
Family Tetramerization domain of potassium channels 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|1dsxG00/33-119
Sequence length 87
Sequence
ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
qsggrlrrpvnvpldifseeirfyelg
Download sequence
Identical sequences 1dsxA 1dsx_A 1dsx_B 1dsx_C 1dsx_D 1dsx_E 1dsx_F 1dsx_G 1dsx_H 000072881|e1dsxF1|226.1.1.2|F:1-87 000072884|e1dsxG1|226.1.1.2|G:1-87 000072886|e1dsxH1|226.1.1.2|H:1-87 000072890|e1dsxD1|226.1.1.2|D:1-87 000072892|e1dsxC1|226.1.1.2|C:1-87 000072893|e1dsxB1|226.1.1.2|B:1-87 000072894|e1dsxE1|226.1.1.2|E:1-87 000072902|e1dsxA1|226.1.1.2|A:1-87 cath|current|1dsxA00/33-119 cath|current|1dsxB00/33-119 cath|current|1dsxC00/33-119 cath|current|1dsxD00/33-119 cath|current|1dsxE00/33-119 cath|current|1dsxF00/33-119 cath|current|1dsxG00/33-119 cath|current|1dsxH00/33-119 d1dsxa_ d1dsxb_ d1dsxc_ d1dsxd_ d1dsxe_ d1dsxf_ d1dsxg_ d1dsxh_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]