SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1f51A02/72-190 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1f51A02/72-190
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily Sporulation response regulatory protein Spo0B 5.62e-38
Family Sporulation response regulatory protein Spo0B 0.000000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|1f51A02/72-190
Sequence length 119
Sequence
KTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESEN
HLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSHECLIEIG
Download sequence
Identical sequences cath|current|1f51A02/72-190 cath|current|1f51B02/272-390 cath|current|1f51C02/472-590 cath|current|1f51D02/672-790 cath|current|1ixmB02/272-390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]