SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1ixmB01/213-271 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1ixmB01/213-271
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily Sporulation response regulatory protein Spo0B 1.44e-24
Family Sporulation response regulatory protein Spo0B 0.000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|1ixmB01/213-271
Sequence length 59
Sequence
SDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNL
Download sequence
Identical sequences cath|current|1f51A01/13-71 cath|current|1f51B01/213-271 cath|current|1f51C01/413-471 cath|current|1f51D01/613-671 cath|current|1ixmB01/213-271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]